Bacillus bataviensis

Bacillus bataviensis Sequence ID: ref|WP_007086548.1|Length: 73Number of Matches: 1 See 1 more title(s) Related Information Identical Proteins-Proteins identical to the subject Range 1: 27 to 71GenPeptGraphics Next Match Previous Match Alignment statistics for match #1 Score Expect Method Identities Positives Gaps 31.6 bits(70) 6.7 Compositional matrix adjust. 12/45(27%) 27/45(60%) 5/45(11%) Query 14 AQQLIGKLQLLLQQAQRDIKLLAYREIVLA-----WASAQRDIKL 53 Q+L+ + + + QRD+ +LAY ++V++ W + Q+ +K+ Sbjct 27 TQELVEEFGITPRTIQRDLNVLAYNDLVISPSRGKWTTTQKKVKM Query line 14 from the HIV glycoprotein region (with molecular tool in selected assay via NCBI-NIH blast tool gives this result.